PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_538.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 174aa    MW: 18973.9 Da    PI: 7.0911
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_538.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.4e-143088563
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                 ++ +r+++NRe+ArrsR RK++ ++ L   v +L +eN++ +  ++  ++++ + +se+
  evm.model.supercontig_538.1 30 RKRKRMISNRESARRSRMRKQKHLDDLMSQVSQLRKENHQIITSVNITTQHYLNIESEN 88
                                 6789***************************************9999999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-112071No hitNo description
SMARTSM003386.9E-192690IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5882891IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.42E-133083No hitNo description
PfamPF001702.3E-113088IPR004827Basic-leucine zipper domain
CDDcd147029.43E-193181No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MASSSGTSSG SSLIQNSGSE EDLQALMDQR KRKRMISNRE SARRSRMRKQ KHLDDLMSQV  60
SQLRKENHQI ITSVNITTQH YLNIESENSV LRAQASELSH RLQSLNEIVS FLNANNGGYG  120
GGNDGGFGGG NSNFTSSSGG ALADHQTAES FLDPFNLIYL NQPIMASADI FQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12950RKRKRMISNRESARRSRMRKQK
24249RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042116.12e-76Basic leucine-zipper 44
TrEMBLA0A061DZX32e-76A0A061DZX3_THECC; Basic leucine-zipper 44
STRINGPOPTR_0009s12250.12e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.15e-47basic leucine-zipper 44